![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.5: HP0062-like [158414] (1 family) ![]() (homo)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
![]() | Family a.25.5.1: HP0062-like [158415] (2 proteins) Pfam PF09647 |
![]() | Protein automated matches [191069] (1 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:210] [188975] (1 PDB entry) |
![]() | Domain d3fx7b_: 3fx7 B: [176129] automated match to d2gtsa1 |
PDB Entry: 3fx7 (more details), 1.65 Å
SCOPe Domain Sequences for d3fx7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fx7b_ a.25.5.1 (B:) automated matches {Helicobacter pylori [TaxId: 210]} qmdteevrefvghlerfkellreevnslsnhfhnleswrdarrdkfsevldnlkstfnef deaaqeqiawlkerirvleedylehhh
Timeline for d3fx7b_: