SCOPe 2.08: Domain d3fwxa_: 3fwx A:

Lineage for d3fwxa_ (3fwx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein automated matches [190200] (9 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:345073] [188814] (1 PDB entry)

8. Domain d3fwxa_: 3fwx A: [176120]
   automated match to d1bs4a_
   complexed with zn

Details for d3fwxa_

PDB Entry: 3fwx, 2 Å

PDB Description: The crystal structure of the peptide deformylase from Vibrio cholerae O1 biovar El Tor str. N16961

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d3fwxa_:

Sequence; same for both SEQRES and ATOM records:

>d3fwxa_ d.167.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 345073]}
vlqvltfpddrlrtvakpveqvtpeiqqivddmletmyaeegiglaatqvdihqrivvid
isetrdqpmvlinpeiiekrgedgieegclsvpgaralvpraaevtvkaldrngqeyqfd
addllaicvqheldhlagklfvdylsplkrnrikeklekikrfne

Timeline for d3fwxa_:

• d3fwxa_ first appeared in SCOPe 2.01
  
• d3fwxa_ appears in SCOPe 2.07