Class a: All alpha proteins [46456] (218 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
Protein Class mu GST [81348] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47622] (7 PDB entries) |
Domain d3gtub1: 3gtu B:85-224 [17612] Other proteins in same PDB: d3gtua2, d3gtub2, d3gtuc2, d3gtud2 |
PDB Entry: 3gtu (more details), 2.8 Å
SCOP Domain Sequences for d3gtub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens)} rkhnmcgeteeekirvdiienqvmdfrtqlirlcyssdheklkpqyleelpgqlkqfsmf lgkfswfagekltfvdfltydildqnrifdpkcldefpnlkafmcrfealekiaaylqsd qfckmpinnkmaqwgnkpvc
Timeline for d3gtub1: