Lineage for d3gtub1 (3gtu B:85-224)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153123Species Human (Homo sapiens), class mu [TaxId:9606] [47622] (7 PDB entries)
  8. 153132Domain d3gtub1: 3gtu B:85-224 [17612]
    Other proteins in same PDB: d3gtua2, d3gtub2, d3gtuc2, d3gtud2

Details for d3gtub1

PDB Entry: 3gtu (more details), 2.8 Å

PDB Description: ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form

SCOP Domain Sequences for d3gtub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gtub1 a.45.1.1 (B:85-224) Glutathione S-transferase {Human (Homo sapiens), class mu}
rkhnmcgeteeekirvdiienqvmdfrtqlirlcyssdheklkpqyleelpgqlkqfsmf
lgkfswfagekltfvdfltydildqnrifdpkcldefpnlkafmcrfealekiaaylqsd
qfckmpinnkmaqwgnkpvc

SCOP Domain Coordinates for d3gtub1:

Click to download the PDB-style file with coordinates for d3gtub1.
(The format of our PDB-style files is described here.)

Timeline for d3gtub1: