SCOPe 2.08: Domain d3fwpf_: 3fwp F:

Lineage for d3fwpf_ (3fwp F:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Uridine phosphorylase [53176] (6 species)

7. Species Salmonella typhimurium [TaxId:90371] [117656] (24 PDB entries)
   Uniprot P0A1F6

8. Domain d3fwpf_: 3fwp F: [176117]
   automated match to d1ryza_
   complexed with anu, k, po4

Details for d3fwpf_

PDB Entry: 3fwp, 1.86 Å

PDB Description: x-ray structure of uridine nucleoside phosphorylease from salmonella typhimurium complexed with phosphate and its inhibitor 2,2'- anhydrouridine at 1.86 a resolution

PDB Compounds: (F:) Uridine phosphorylase

SCOPe Domain Sequences for d3fwpf_:

Sequence, based on SEQRES records:

>d3fwpf_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
ksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkav
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
fapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
kivveaarrll

Sequence, based on observed residues (ATOM records):

>d3fwpf_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
ksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkav
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
fapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeshavkivveaarrll

Timeline for d3fwpf_:

• d3fwpf_ first appeared in SCOPe 2.01
  
• d3fwpf_ appears in SCOPe 2.07