Lineage for d3fw3b_ (3fw3 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1328735Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1328736Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1328737Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1328738Protein Carbonic anhydrase [51071] (10 species)
  7. 1329241Species Human (Homo sapiens), isozyme IV [TaxId:9606] [51076] (4 PDB entries)
  8. 1329243Domain d3fw3b_: 3fw3 B: [176093]
    automated match to d1znca_
    complexed with ets, glc, so4, zn

Details for d3fw3b_

PDB Entry: 3fw3 (more details), 1.72 Å

PDB Description: Crystal Structure of soluble domain of CA4 in complex with Dorzolamide
PDB Compounds: (B:) Carbonic anhydrase 4

SCOPe Domain Sequences for d3fw3b_:

Sequence, based on SEQRES records: (download)

>d3fw3b_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
hwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtw
tvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhi
vhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmae
sslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydke
qtvsmkdnvrplqqlgqrtviks

Sequence, based on observed residues (ATOM records): (download)

>d3fw3b_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
hwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtw
tvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhi
vhekeeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaesslldllp
keeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvsmkdn
vrplqqlgqrtviks

SCOPe Domain Coordinates for d3fw3b_:

Click to download the PDB-style file with coordinates for d3fw3b_.
(The format of our PDB-style files is described here.)

Timeline for d3fw3b_: