Lineage for d1gtuc1 (1gtu C:85-217)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443530Protein Class mu GST [81348] (3 species)
  7. 443538Species Human (Homo sapiens) [TaxId:9606] [47622] (7 PDB entries)
  8. 443544Domain d1gtuc1: 1gtu C:85-217 [17609]
    Other proteins in same PDB: d1gtua2, d1gtub2, d1gtuc2, d1gtud2

Details for d1gtuc1

PDB Entry: 1gtu (more details), 2.68 Å

PDB Description: ligand-free human glutathione s-transferase m1a-1a

SCOP Domain Sequences for d1gtuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtuc1 a.45.1.1 (C:85-217) Class mu GST {Human (Homo sapiens)}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOP Domain Coordinates for d1gtuc1:

Click to download the PDB-style file with coordinates for d1gtuc1.
(The format of our PDB-style files is described here.)

Timeline for d1gtuc1: