Lineage for d3fvic_ (3fvi C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733467Species Pig (Sus scrofa) [TaxId:9823] [186957] (9 PDB entries)
  8. 2733477Domain d3fvic_: 3fvi C: [176078]
    automated match to d1hn4a_
    complexed with ca, cl, na, osf

Details for d3fvic_

PDB Entry: 3fvi (more details), 2.7 Å

PDB Description: Crystal Structure of Complex of Phospholipase A2 with Octyl Sulfates
PDB Compounds: (C:) phospholipase a2, major isoenzyme

SCOPe Domain Sequences for d3fvic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fvic_ a.133.1.2 (C:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

SCOPe Domain Coordinates for d3fvic_:

Click to download the PDB-style file with coordinates for d3fvic_.
(The format of our PDB-style files is described here.)

Timeline for d3fvic_: