Lineage for d3fv3e_ (3fv3 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2802457Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2802458Protein automated matches [190954] (13 species)
    not a true protein
  7. 2802468Species Candida parapsilosis [TaxId:5480] [188902] (2 PDB entries)
  8. 2802473Domain d3fv3e_: 3fv3 E: [176071]
    automated match to d1j71a_
    complexed with gol, so4

Details for d3fv3e_

PDB Entry: 3fv3 (more details), 1.85 Å

PDB Description: Secreted aspartic protease 1 from Candida parapsilosis in complex with pepstatin A
PDB Compounds: (E:) Sapp1p-secreted aspartic protease 1

SCOPe Domain Sequences for d3fv3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fv3e_ b.50.1.0 (E:) automated matches {Candida parapsilosis [TaxId: 5480]}
dsislslinegpsyaskvsvgsnkqqqtviidtgssdfwvvdsnaqcgkgvdckssgtft
psssssyknlgaaftirygdgstsqgtwgkdtvtingvsitgqqiadvtqtsvdqgilgi
gytsneavydtsgrqttpnydnvpvtlkkqgkirtnayslylnspsaetgtiifggvdna
kysgklvaeqvtssqaltislasvnlkgssfsfgdgalldsgttltyfpsdfaaqladka
garlvqvardqylyfidcntdtsgttvfnfgngakitvpnteyvyqngdgtclwgiqpsd
dtilgdnflrhayllynldantisiaqvkyttdssisav

SCOPe Domain Coordinates for d3fv3e_:

Click to download the PDB-style file with coordinates for d3fv3e_.
(The format of our PDB-style files is described here.)

Timeline for d3fv3e_: