Class a: All alpha proteins [46456] (218 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
Protein Class mu GST [81348] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47622] (7 PDB entries) |
Domain d1gtua1: 1gtu A:85-217 [17607] Other proteins in same PDB: d1gtua2, d1gtub2, d1gtuc2, d1gtud2 |
PDB Entry: 1gtu (more details), 2.68 Å
SCOP Domain Sequences for d1gtua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtua1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens)} lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp rpvfskmavwgnk
Timeline for d1gtua1: