Lineage for d1gtua1 (1gtu A:85-217)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213854Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 213855Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 213856Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 213954Protein Class mu GST [81348] (3 species)
  7. 213962Species Human (Homo sapiens) [TaxId:9606] [47622] (7 PDB entries)
  8. 213966Domain d1gtua1: 1gtu A:85-217 [17607]
    Other proteins in same PDB: d1gtua2, d1gtub2, d1gtuc2, d1gtud2

Details for d1gtua1

PDB Entry: 1gtu (more details), 2.68 Å

PDB Description: ligand-free human glutathione s-transferase m1a-1a

SCOP Domain Sequences for d1gtua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtua1 a.45.1.1 (A:85-217) Class mu GST {Human (Homo sapiens)}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOP Domain Coordinates for d1gtua1:

Click to download the PDB-style file with coordinates for d1gtua1.
(The format of our PDB-style files is described here.)

Timeline for d1gtua1: