SCOP 1.63: Domain d2gtub1: 2gtu B:85-217

Lineage for d2gtub1 (2gtu B:85-217)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (7 PDB entries)

8. Domain d2gtub1: 2gtu B:85-217 [17606]
   Other proteins in same PDB: d2gtua2, d2gtub2

Details for d2gtub1

PDB Entry: 2gtu, 2.55 Å

PDB Description: ligand-free human glutathione s-transferase m2-2 (e.c.2.5.1.18), monoclinic crystal form

SCOP Domain Sequences for d2gtub1:

Sequence; same for both SEQRES and ATOM records:

>d2gtub1 a.45.1.1 (B:85-217) Class mu GST {Human (Homo sapiens)}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavwgnk

Timeline for d2gtub1:

• d2gtub1 first appeared (with stable ids) in SCOP 1.55
  
• d2gtub1 appears in SCOP 1.61
  
• d2gtub1 appears in SCOP 1.65
  
• d2gtub1 appears in the current release, SCOPe 2.08