SCOPe 2.05: Domain d3ftbe_: 3ftb E:

Lineage for d3ftbe_ (3ftb E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (98 species)
   not a true protein

7. Species Clostridium acetobutylicum [TaxId:1488] [188774] (1 PDB entry)

8. Domain d3ftbe_: 3ftb E: [176058]
   automated match to d1lc5a_
   complexed with po4

Details for d3ftbe_

PDB Entry: 3ftb, 2 Å

PDB Description: the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum

PDB Compounds: (E:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3ftbe_:

Sequence; same for both SEQRES and ATOM records:

>d3ftbe_ c.67.1.0 (E:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
lldyssninplgipksflnnidegiknlgvypdvnyrrlnksienylklkdigivlgnga
seiielsislfekiliivpsyaeyeinakkhgvsvvfsyldenmcidyediiskiddvds
viignpnnpngglinkekfihvlklaeekkktiiideafieftgdpsssfvgeiknyscl
fiiramtkffampgirfgygitnnkeiaakikakqnpwnincfaemaainclkdtnyiee
sllwikkerkrfieelnkigfikrvfsphanfvlcrlenisgeklydsllkedivirrcc
nfiglddsfvrfaikdekkntkflralkgvennl

Timeline for d3ftbe_:

• d3ftbe_ first appeared in SCOPe 2.01
  
• d3ftbe_ appears in SCOPe 2.04
  
• d3ftbe_ appears in SCOPe 2.06
  
• d3ftbe_ appears in the current release, SCOPe 2.08