SCOPe 2.06: Domain d3ftbb_: 3ftb B:

Lineage for d3ftbb_ (3ftb B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (121 species)
   not a true protein

7. Species Clostridium acetobutylicum [TaxId:1488] [188774] (1 PDB entry)

8. Domain d3ftbb_: 3ftb B: [176056]
   automated match to d1lc5a_
   complexed with po4

Details for d3ftbb_

PDB Entry: 3ftb, 2 Å

PDB Description: the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum

PDB Compounds: (B:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3ftbb_:

Sequence; same for both SEQRES and ATOM records:

>d3ftbb_ c.67.1.0 (B:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
lldyssninplgipksflnnidegiknlgvypdvnyrrlnksienylklkdigivlgnga
seiielsislfekiliivpsyaeyeinakkhgvsvvfsyldenmcidyediiskiddvds
viignpnnpngglinkekfihvlklaeekkktiiideafieftgdpsssfvgeiknyscl
fiiramtkffampgirfgygitnnkeiaakikakqnpwnincfaemaainclkdtnyiee
sllwikkerkrfieelnkigfikrvfsphanfvlcrlenisgeklydsllkedivirrcc
nfiglddsfvrfaikdekkntkflralkgvennl

Timeline for d3ftbb_:

• d3ftbb_ first appeared in SCOPe 2.01
  
• d3ftbb_ appears in SCOPe 2.05
  
• d3ftbb_ appears in SCOPe 2.07
  
• d3ftbb_ appears in the current release, SCOPe 2.08