Lineage for d1gtif1 (1gti F:79-209)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213854Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 213855Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 213856Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 214038Protein Class pi GST [81347] (3 species)
  7. 214117Species Mouse (Mus musculus) [TaxId:10090] [47621] (6 PDB entries)
  8. 214133Domain d1gtif1: 1gti F:79-209 [17603]
    Other proteins in same PDB: d1gtia2, d1gtib2, d1gtic2, d1gtid2, d1gtie2, d1gtif2
    complexed with cay, gtb

Details for d1gtif1

PDB Entry: 1gti (more details), 3 Å

PDB Description: modified glutathione s-transferase (pi) complexed with s (p-nitrobenzyl)glutathione

SCOP Domain Sequences for d1gtif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtif1 a.45.1.1 (F:79-209) Class pi GST {Mouse (Mus musculus)}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOP Domain Coordinates for d1gtif1:

Click to download the PDB-style file with coordinates for d1gtif1.
(The format of our PDB-style files is described here.)

Timeline for d1gtif1: