SCOPe 2.05: Domain d3fsha_: 3fsh A:

Lineage for d3fsha_ (3fsh A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188773] (1 PDB entry)

8. Domain d3fsha_: 3fsh A: [176026]
   automated match to d2ucza_

Details for d3fsha_

PDB Entry: 3fsh, 2.76 Å

PDB Description: Crystal structure of the ubiquitin conjugating enzyme Ube2g2 bound to the G2BR domain of ubiquitin ligase gp78

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 G2

SCOPe Domain Sequences for d3fsha_:

Sequence; same for both SEQRES and ATOM records:

>d3fsha_ d.20.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
shmagtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpail
sfpldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsvek
illsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl

Timeline for d3fsha_:

• d3fsha_ first appeared in SCOPe 2.01
  
• d3fsha_ appears in SCOPe 2.04
  
• d3fsha_ is called d3fsha1 in SCOPe 2.06
  
• d3fsha_ appears in the current release, SCOPe 2.08, called d3fsha1