Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (43 species) not a true protein |
Species Struthio camelus [TaxId:8801] [188835] (1 PDB entry) |
Domain d3fs4c_: 3fs4 C: [176011] automated match to d1fawa_ complexed with hem, oxy |
PDB Entry: 3fs4 (more details), 2.22 Å
SCOPe Domain Sequences for d3fs4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fs4c_ a.1.1.2 (C:) automated matches {Struthio camelus [TaxId: 8801]} vlsgtdktnvkgifskisshaeeygaetlermfitypqtktyfphfdlhhgsaqikahgk kvanalieavnhiddisgalsklsdlhaqklrvdpvnfkllgqcflvvvaihhpsaltpe vhasldkflcavgavltakyr
Timeline for d3fs4c_: