SCOPe 2.01: Domain d3fs1a_: 3fs1 A:

Lineage for d3fs1a_ (3fs1 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries)

8. Domain d3fs1a_: 3fs1 A: [176008]
   automated match to d1pzla_
   protein/DNA complex; complexed with myr

Details for d3fs1a_

PDB Entry: 3fs1, 2.2 Å

PDB Description: crystal structure of hnf4a lbd in complex with the ligand and the coactivator pgc-1a fragment

PDB Compounds: (A:) Hepatocyte nuclear factor 4-alpha

SCOPe Domain Sequences for d3fs1a_:

Sequence; same for both SEQRES and ATOM records:

>d3fs1a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpsinallqaevlsrqitspvsgingdirakkiasiadvcesmkeqllvlvewakyipa
fcelplddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsir
ildelvlpfqelqiddneyaylkaiiffdpdakglsdpgkikrlrsqvqvsledyindrq
ydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllgg

Timeline for d3fs1a_:

• d3fs1a_ is new in SCOPe 2.01-stable
  
• d3fs1a_ appears in SCOPe 2.02
  
• d3fs1a_ appears in the current release, SCOPe 2.08