Lineage for d1gtic1 (1gti C:79-209)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153267Species Mouse (Mus musculus), class pi [TaxId:10090] [47621] (6 PDB entries)
  8. 153280Domain d1gtic1: 1gti C:79-209 [17600]
    Other proteins in same PDB: d1gtia2, d1gtib2, d1gtic2, d1gtid2, d1gtie2, d1gtif2

Details for d1gtic1

PDB Entry: 1gti (more details), 3 Å

PDB Description: modified glutathione s-transferase (pi) complexed with s (p-nitrobenzyl)glutathione

SCOP Domain Sequences for d1gtic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtic1 a.45.1.1 (C:79-209) Glutathione S-transferase {Mouse (Mus musculus), class pi}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOP Domain Coordinates for d1gtic1:

Click to download the PDB-style file with coordinates for d1gtic1.
(The format of our PDB-style files is described here.)

Timeline for d1gtic1: