Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species) |
Species Staphylococcus aureus [TaxId:1280] [188976] (33 PDB entries) |
Domain d3frex_: 3fre X: [175999] automated match to d1dhja_ complexed with ndp, top |
PDB Entry: 3fre (more details), 2.2 Å
SCOPe Domain Sequences for d3frex_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3frex_ c.71.1.1 (X:) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]} tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd tffppytfedwevassvegkldekntiphtflhlirk
Timeline for d3frex_: