Lineage for d3frex_ (3fre X:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903517Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)
  7. 2903719Species Staphylococcus aureus [TaxId:1280] [188976] (33 PDB entries)
  8. 2903745Domain d3frex_: 3fre X: [175999]
    automated match to d1dhja_
    complexed with ndp, top

Details for d3frex_

PDB Entry: 3fre (more details), 2.2 Å

PDB Description: S. aureus DHFR complexed with NADPH and TMP
PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d3frex_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frex_ c.71.1.1 (X:) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d3frex_:

Click to download the PDB-style file with coordinates for d3frex_.
(The format of our PDB-style files is described here.)

Timeline for d3frex_: