Lineage for d3fqha_ (3fqh A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043558Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 1043559Species Human (Homo sapiens) [TaxId:9606] [118132] (8 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 1043566Domain d3fqha_: 3fqh A: [175977]
    automated match to d1xbba_
    complexed with 057

Details for d3fqha_

PDB Entry: 3fqh (more details), 2.26 Å

PDB Description: crystal structure of spleen tyrosine kinase complexed with a 2- substituted 7-azaindole
PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d3fqha_:

Sequence, based on SEQRES records: (download)

>d3fqha_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
dlmnlcwtydvenrpgfaavelrlrnyyydvv

Sequence, based on observed residues (ATOM records): (download)

>d3fqha_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqqldnpyi
vrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesnfvh
rdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykfssk
sdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtyd
venrpgfaavelrlrnyyydvv

SCOPe Domain Coordinates for d3fqha_:

Click to download the PDB-style file with coordinates for d3fqha_.
(The format of our PDB-style files is described here.)

Timeline for d3fqha_: