Lineage for d3fpqb_ (3fpq B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589303Protein Protein kinase wnk1 [111196] (1 species)
    OPK group; WNK subfamily; serine/threonine kinase
  7. 2589304Species Human (Homo sapiens) [TaxId:9606] [111197] (7 PDB entries)
    Uniprot Q9JIH7 211-480
  8. 2589306Domain d3fpqb_: 3fpq B: [175957]
    complexed with gol, so4

Details for d3fpqb_

PDB Entry: 3fpq (more details), 1.8 Å

PDB Description: crystal structure of the kinase domain of wnk1
PDB Compounds: (B:) Serine/threonine-protein kinase WNK1

SCOPe Domain Sequences for d3fpqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fpqb_ d.144.1.7 (B:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]}
kavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeea
emlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswcr
qilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfakavigtpef
mapemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkvai
pevkeiiegcirqnkderysikdllnhaffqe

SCOPe Domain Coordinates for d3fpqb_:

Click to download the PDB-style file with coordinates for d3fpqb_.
(The format of our PDB-style files is described here.)

Timeline for d3fpqb_: