Lineage for d3fpqa_ (3fpq A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221307Protein Protein kinase wnk1 [111196] (1 species)
    OPK group; WNK subfamily; serine/threonine kinase
  7. 1221308Species Human (Homo sapiens) [TaxId:9606] [111197] (1 PDB entry)
    Uniprot Q9JIH7 211-480
  8. 1221309Domain d3fpqa_: 3fpq A: [175956]
    complexed with gol, so4

Details for d3fpqa_

PDB Entry: 3fpq (more details), 1.8 Å

PDB Description: crystal structure of the kinase domain of wnk1
PDB Compounds: (A:) Serine/threonine-protein kinase WNK1

SCOPe Domain Sequences for d3fpqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fpqa_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]}
kavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeea
emlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswcr
qilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfakavigtpef
mapemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkvai
pevkeiiegcirqnkderysikdllnhaffq

SCOPe Domain Coordinates for d3fpqa_:

Click to download the PDB-style file with coordinates for d3fpqa_.
(The format of our PDB-style files is described here.)

Timeline for d3fpqa_: