Lineage for d3foua_ (3fou A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782335Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2782420Protein automated matches [190874] (7 species)
    not a true protein
  7. 2782459Species Thermus thermophilus HB8 [TaxId:300852] [189085] (1 PDB entry)
  8. 2782460Domain d3foua_: 3fou A: [175947]
    automated match to d1nyka_
    complexed with act, ca, fes, pr

Details for d3foua_

PDB Entry: 3fou (more details), 2.1 Å

PDB Description: Low pH structure of the Rieske protein from Thermus thermophilus at 2.1 A
PDB Compounds: (A:) Quinol-cytochrome c reductase, Rieske iron-sulfur subunit

SCOPe Domain Sequences for d3foua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3foua_ b.33.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
viagppprpvpqlpvrvedgvlvaageflgpvgvqa

SCOPe Domain Coordinates for d3foua_:

Click to download the PDB-style file with coordinates for d3foua_.
(The format of our PDB-style files is described here.)

Timeline for d3foua_: