Lineage for d3fonb_ (3fon B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1290588Protein beta2-microglobulin [88600] (5 species)
  7. 1291129Species Mouse (Mus musculus) [TaxId:10090] [88603] (155 PDB entries)
    Uniprot P01887
  8. 1291189Domain d3fonb_: 3fon B: [175933]
    automated match to d1bz9b_

Details for d3fonb_

PDB Entry: 3fon (more details), 2.03 Å

PDB Description: crystal structure of the class i mhc molecule h-2kwm7 with a single self peptide vndifeai
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d3fonb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fonb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d3fonb_:

Click to download the PDB-style file with coordinates for d3fonb_.
(The format of our PDB-style files is described here.)

Timeline for d3fonb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3fond_