Lineage for d1glpb1 (1glp B:79-209)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153267Species Mouse (Mus musculus), class pi [TaxId:10090] [47621] (6 PDB entries)
  8. 153271Domain d1glpb1: 1glp B:79-209 [17591]
    Other proteins in same PDB: d1glpa2, d1glpb2

Details for d1glpb1

PDB Entry: 1glp (more details), 1.9 Å

PDB Description: 1.8 angstroms molecular structure of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors

SCOP Domain Sequences for d1glpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glpb1 a.45.1.1 (B:79-209) Glutathione S-transferase {Mouse (Mus musculus), class pi}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOP Domain Coordinates for d1glpb1:

Click to download the PDB-style file with coordinates for d1glpb1.
(The format of our PDB-style files is described here.)

Timeline for d1glpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glpb2