Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Listeria innocua [TaxId:272626] [188770] (1 PDB entry) |
Domain d3fnca_: 3fnc A: [175909] Other proteins in same PDB: d3fncb2 automated match to d1wk4a_ complexed with edo, mli |
PDB Entry: 3fnc (more details), 1.75 Å
SCOPe Domain Sequences for d3fnca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fnca_ d.108.1.0 (A:) automated matches {Listeria innocua [TaxId: 272626]} mdfhirkatnsdaeaiqhvattswhhtyqdlipsdvqddflkrfynvetlhnrisatpfa vleqadkvigfanfielekgkselaafyllpevtqrglgtellevgmtlfhvplpmfvnv ekgnetaihfykakgfvqveeftedfygypletirfnlnh
Timeline for d3fnca_: