SCOPe 2.08: Domain d3fl8c1: 3fl8 C:1-162

Lineage for d3fl8c1 (3fl8 C:1-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (28 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)

8. Domain d3fl8c1: 3fl8 C:1-162 [175875]
   Other proteins in same PDB: d3fl8a2, d3fl8b2, d3fl8c2, d3fl8d2, d3fl8e2, d3fl8f2, d3fl8g2, d3fl8h2
   automated match to d1draa_
   complexed with ca, rar

Details for d3fl8c1

PDB Entry: 3fl8, 2.29 Å

PDB Description: Crystal structure of B. anthracis dihydrofolate reductase (DHFR) with RAB1, a TMP-dihydrophthalazine derivative

PDB Compounds: (C:) dihydrofolate reductase

SCOPe Domain Sequences for d3fl8c1:

Sequence; same for both SEQRES and ATOM records:

>d3fl8c1 c.71.1.0 (C:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Timeline for d3fl8c1:

• d3fl8c1 first appeared in SCOPe 2.01, called d3fl8c_
  
• d3fl8c1 appears in SCOPe 2.07