Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class pi GST [81347] (4 species) |
Species Pig (Sus scrofa) [TaxId:9823] [47620] (1 PDB entry) |
Domain d2gsrb1: 2gsr B:77-207 [17587] Other proteins in same PDB: d2gsra2, d2gsrb2 complexed with gts |
PDB Entry: 2gsr (more details), 2.11 Å
SCOPe Domain Sequences for d2gsrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gsrb1 a.45.1.1 (B:77-207) Class pi GST {Pig (Sus scrofa) [TaxId: 9823]} ygkdqkeaalvdmvndgvedlrckyatliytnyeagkekyvkelpehlkpfetllsqnqg gqafvvgsqisfadynlldllrihqvlnpscldafpllsayvarlsarpkikaflaspeh vnrpingngkq
Timeline for d2gsrb1: