SCOPe 2.08: Domain d3fkza_: 3fkz A:

Lineage for d3fkza_ (3fkz A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries)

8. Domain d3fkza_: 3fkz A: [175863]
   automated match to d1a2wa_
   mutant

Details for d3fkza_

PDB Entry: 3fkz, 1.99 Å

PDB Description: x-ray structure of the non covalent swapped form of the s16g/t17n/a19p/a20s/k31c/s32c mutant of bovine pancreatic ribonuclease

PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d3fkza_:

Sequence; same for both SEQRES and ATOM records:

>d3fkza_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsgnspssssnycnqmmccrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d3fkza_:

• d3fkza_ first appeared in SCOPe 2.01
  
• d3fkza_ appears in SCOPe 2.07