SCOPe 2.01: Domain d3fkvb_: 3fkv B:

Lineage for d3fkvb_ (3fkv B:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (66 PDB entries)

8. Domain d3fkvb_: 3fkv B: [175860]
   automated match to d1c3ba_
   complexed with bzb, k, po4; mutant

Details for d3fkvb_

PDB Entry: 3fkv, 1.85 Å

PDB Description: ampc k67r mutant complexed with benzo(b)thiophene-2-boronic acid (bzb)

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3fkvb_:

Sequence; same for both SEQRES and ATOM records:

>d3fkvb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsrtftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d3fkvb_:

• d3fkvb_ is new in SCOPe 2.01-stable
  
• d3fkvb_ appears in SCOPe 2.02
  
• d3fkvb_ appears in the current release, SCOPe 2.08