Lineage for d2gsra1 (2gsr A:77-207)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48057Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 48058Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 48059Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)
  6. 48063Protein Glutathione S-transferase [47618] (24 species)
  7. 48257Species Pig (Sus scrofa), class pi [47620] (1 PDB entry)
  8. 48258Domain d2gsra1: 2gsr A:77-207 [17586]
    Other proteins in same PDB: d2gsra2, d2gsrb2

Details for d2gsra1

PDB Entry: 2gsr (more details), 2.11 Å

PDB Description: structure of porcine class pi glutathione s-transferase

SCOP Domain Sequences for d2gsra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsra1 a.45.1.1 (A:77-207) Glutathione S-transferase {Pig (Sus scrofa), class pi}
ygkdqkeaalvdmvndgvedlrckyatliytnyeagkekyvkelpehlkpfetllsqnqg
gqafvvgsqisfadynlldllrihqvlnpscldafpllsayvarlsarpkikaflaspeh
vnrpingngkq

SCOP Domain Coordinates for d2gsra1:

Click to download the PDB-style file with coordinates for d2gsra1.
(The format of our PDB-style files is described here.)

Timeline for d2gsra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsra2