Lineage for d2gsra1 (2gsr A:77-207)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713204Protein Class pi GST [81347] (4 species)
  7. 2713386Species Pig (Sus scrofa) [TaxId:9823] [47620] (1 PDB entry)
  8. 2713387Domain d2gsra1: 2gsr A:77-207 [17586]
    Other proteins in same PDB: d2gsra2, d2gsrb2
    complexed with gts

Details for d2gsra1

PDB Entry: 2gsr (more details), 2.11 Å

PDB Description: structure of porcine class pi glutathione s-transferase
PDB Compounds: (A:) class pi gst glutathione s-transferase

SCOPe Domain Sequences for d2gsra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsra1 a.45.1.1 (A:77-207) Class pi GST {Pig (Sus scrofa) [TaxId: 9823]}
ygkdqkeaalvdmvndgvedlrckyatliytnyeagkekyvkelpehlkpfetllsqnqg
gqafvvgsqisfadynlldllrihqvlnpscldafpllsayvarlsarpkikaflaspeh
vnrpingngkq

SCOPe Domain Coordinates for d2gsra1:

Click to download the PDB-style file with coordinates for d2gsra1.
(The format of our PDB-style files is described here.)

Timeline for d2gsra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsra2