Lineage for d1gssb1 (1gss B:77-207)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153151Species Human (Homo sapiens), class pi [TaxId:9606] [47619] (33 PDB entries)
  8. 153228Domain d1gssb1: 1gss B:77-207 [17585]
    Other proteins in same PDB: d1gssa2, d1gssb2

Details for d1gssb1

PDB Entry: 1gss (more details), 2.8 Å

PDB Description: three-dimensional structure of class pi glutathione s-transferase from human placenta in complex with s-hexylglutathione at 2.8 angstroms resolution

SCOP Domain Sequences for d1gssb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gssb1 a.45.1.1 (B:77-207) Glutathione S-transferase {Human (Homo sapiens), class pi}
ygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqnqg
gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey
vnlpingngkq

SCOP Domain Coordinates for d1gssb1:

Click to download the PDB-style file with coordinates for d1gssb1.
(The format of our PDB-style files is described here.)

Timeline for d1gssb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gssb2