SCOP 1.69: Domain d20gsb1: 20gs B:77-209

Lineage for d20gsb1 (20gs B:77-209)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class pi GST [81347] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (36 PDB entries)

8. Domain d20gsb1: 20gs B:77-209 [17583]
   Other proteins in same PDB: d20gsa2, d20gsb2

Details for d20gsb1

PDB Entry: 20gs, 2.45 Å

PDB Description: glutathione s-transferase p1-1 complexed with cibacron blue

SCOP Domain Sequences for d20gsb1:

Sequence; same for both SEQRES and ATOM records:

>d20gsb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d20gsb1:

• d20gsb1 first appeared (with stable ids) in SCOP 1.55
  
• d20gsb1 appears in SCOP 1.67
  
• d20gsb1 appears in SCOP 1.71
  
• d20gsb1 appears in the current release, SCOPe 2.08