Lineage for d3fi6a_ (3fi6 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264124Protein (Apo)ferritin [47246] (8 species)
  7. 1264169Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (46 PDB entries)
  8. 1264196Domain d3fi6a_: 3fi6 A: [175820]
    automated match to d1data_
    complexed with cd, pd, so4

Details for d3fi6a_

PDB Entry: 3fi6 (more details), 1.8 Å

PDB Description: apo-h49afr with high content of pd ions
PDB Compounds: (A:) ferritin light chain

SCOPe Domain Sequences for d3fi6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fi6a_ a.25.1.1 (A:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvcaffrelaeekreg
aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkh

SCOPe Domain Coordinates for d3fi6a_:

Click to download the PDB-style file with coordinates for d3fi6a_.
(The format of our PDB-style files is described here.)

Timeline for d3fi6a_: