Lineage for d1eohh1 (1eoh H:77-209)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3768Species Human (Homo sapiens), class pi [TaxId:9606] [47619] (30 PDB entries)
  8. 3835Domain d1eohh1: 1eoh H:77-209 [17581]
    Other proteins in same PDB: d1eoha2, d1eohb2, d1eohc2, d1eohd2, d1eohe2, d1eohf2, d1eohg2, d1eohh2

Details for d1eohh1

PDB Entry: 1eoh (more details), 2.5 Å

PDB Description: glutathione transferase p1-1

SCOP Domain Sequences for d1eohh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eohh1 a.45.1.1 (H:77-209) Glutathione S-transferase {Human (Homo sapiens), class pi}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfaaynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d1eohh1:

Click to download the PDB-style file with coordinates for d1eohh1.
(The format of our PDB-style files is described here.)

Timeline for d1eohh1: