Lineage for d1eohg1 (1eoh G:77-209)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538429Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 538430Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 538431Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 538661Protein Class pi GST [81347] (4 species)
  7. 538662Species Human (Homo sapiens) [TaxId:9606] [47619] (36 PDB entries)
  8. 538738Domain d1eohg1: 1eoh G:77-209 [17580]
    Other proteins in same PDB: d1eoha2, d1eohb2, d1eohc2, d1eohd2, d1eohe2, d1eohf2, d1eohg2, d1eohh2

Details for d1eohg1

PDB Entry: 1eoh (more details), 2.5 Å

PDB Description: glutathione transferase p1-1

SCOP Domain Sequences for d1eohg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eohg1 a.45.1.1 (G:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfaaynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d1eohg1:

Click to download the PDB-style file with coordinates for d1eohg1.
(The format of our PDB-style files is described here.)

Timeline for d1eohg1: