Lineage for d3fhxb_ (3fhx B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904548Family c.72.1.5: PfkB-like kinase [82515] (3 proteins)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 2904577Protein automated matches [190479] (4 species)
    not a true protein
  7. 2904580Species Human (Homo sapiens) [TaxId:9606] [187406] (10 PDB entries)
  8. 2904594Domain d3fhxb_: 3fhx B: [175795]
    automated match to d1rfua_
    complexed with atp, mg, mpd, na, plp, pxl, so4; mutant

Details for d3fhxb_

PDB Entry: 3fhx (more details), 2.5 Å

PDB Description: crystal structure of d235a mutant of human pyridoxal kinase
PDB Compounds: (B:) Pyridoxal kinase

SCOPe Domain Sequences for d3fhxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhxb_ c.72.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eecrvlsiqshvirgyvgnraatfplqvlgfeidavnsvqfsnhtgyahwkgqvlnsdel
qelyeglrlnnmnkydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvlgdkwdg
egsmyvpedllpvykekvvpladiitpnqfeaellsgrkihsqeealrvmdmlhsmgpdt
vvitssdlpspqgsnylivlgsqrrrnpagsvvmerirmdirkvdavfvgtgalfaamll
awthkhpnnlkvacektvstlhhvlqrtiqcakaqagegvrpspmqlelrmvqskrdied
peivvqatvl

SCOPe Domain Coordinates for d3fhxb_:

Click to download the PDB-style file with coordinates for d3fhxb_.
(The format of our PDB-style files is described here.)

Timeline for d3fhxb_: