SCOPe 2.06: Domain d3fgza_: 3fgz A:

Lineage for d3fgza_ (3fgz A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (7 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189043] (17 PDB entries)

8. Domain d3fgza_: 3fgz A: [175778]
   automated match to d1miha_
   complexed with bef, gol, mn, nh4; mutant

Details for d3fgza_

PDB Entry: 3fgz, 2 Å

PDB Description: crystal structure of chey triple mutant f14e, n59m, e89r complexed with bef3- and mn2+

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3fgza_:

Sequence; same for both SEQRES and ATOM records:

>d3fgza_ c.23.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d3fgza_:

• d3fgza_ first appeared in SCOPe 2.01
  
• d3fgza_ appears in SCOPe 2.05
  
• d3fgza_ appears in SCOPe 2.07
  
• d3fgza_ appears in the current release, SCOPe 2.08