SCOPe 2.04: Domain d3fgya_: 3fgy A:

Lineage for d3fgya_ (3fgy A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (19 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [188714] (1 PDB entry)

8. Domain d3fgya_: 3fgy A: [175776]
   automated match to d3ebta1
   complexed with peg, unl

Details for d3fgya_

PDB Entry: 3fgy, 1.59 Å

PDB Description: crystal structure of a ntf2-like protein (bxe_b1094) from burkholderia xenovorans lb400 at 1.59 a resolution

PDB Compounds: (A:) uncharacterized NTF2-like protein

SCOPe Domain Sequences for d3fgya_:

Sequence; same for both SEQRES and ATOM records:

>d3fgya_ d.17.4.0 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
gmstqenvqivkdffaamgrgdkkgllavsaediewiipgewplagthrghaalaallqk
asemveisypeppefvaqgervlvvgfatgrvkstnrtfeddwvfaitvrkskvtsirey
idtlalaratnfnat

Timeline for d3fgya_:

• d3fgya_ first appeared in SCOPe 2.01
  
• d3fgya_ appears in SCOPe 2.03
  
• d3fgya_ appears in SCOPe 2.05
  
• d3fgya_ appears in the current release, SCOPe 2.08, called d3fgya1