Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) consists of clearly related families of somewhat different folds |
Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (3 proteins) typical (beta/alpha)8-barrel fold heterodimer of two similar chains |
Protein automated matches [191049] (2 species) not a true protein |
Species Vibrio harveyi [TaxId:669] [188897] (1 PDB entry) |
Domain d3fgcc_: 3fgc C: [175771] Other proteins in same PDB: d3fgcd2 automated match to d1brla_ complexed with fmn, po4, so4 |
PDB Entry: 3fgc (more details), 2.3 Å
SCOPe Domain Sequences for d3fgcc_:
Sequence, based on SEQRES records: (download)
>d3fgcc_ c.1.16.1 (C:) automated matches {Vibrio harveyi [TaxId: 669]} mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak dicrnflghwydsyvnatkifddsdqtkgydfnkgqwrdfvlkghkdtnrridysyeinp vgtpeeciaiiqqdidatgidniccgfeangseeeiiasmklfqsdvmpylkekq
>d3fgcc_ c.1.16.1 (C:) automated matches {Vibrio harveyi [TaxId: 669]} mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak dicrnflghwydsyvnatkifddsdqtkgydfnkgqwrdfvlkridysyeinpvgtpeec iaiiqqdidatgidniccgfeangseeeiiasmklfqsdvmpylkekq
Timeline for d3fgcc_:
View in 3D Domains from other chains: (mouse over for more information) d3fgca_, d3fgcb_, d3fgcd1, d3fgcd2 |