Lineage for d3ffxa_ (3ffx A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2114717Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2114998Protein automated matches [190177] (7 species)
    not a true protein
  7. 2115006Species Escherichia coli K-12 [TaxId:83333] [189043] (17 PDB entries)
  8. 2115019Domain d3ffxa_: 3ffx A: [175764]
    automated match to d1miha_
    complexed with bef, gol, mn, so4; mutant

Details for d3ffxa_

PDB Entry: 3ffx (more details), 2.01 Å

PDB Description: crystal structure of chey triple mutant f14e, n59r, e89h complexed with bef3- and mn2+
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3ffxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ffxa_ c.23.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwrmp
nmdglellktiradgamsalpvlmvtahakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d3ffxa_:

Click to download the PDB-style file with coordinates for d3ffxa_.
(The format of our PDB-style files is described here.)

Timeline for d3ffxa_: