Lineage for d3ffwb_ (3ffw B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855710Protein automated matches [190177] (9 species)
    not a true protein
  7. 2855718Species Escherichia coli K-12 [TaxId:83333] [189043] (16 PDB entries)
  8. 2855732Domain d3ffwb_: 3ffw B: [175763]
    automated match to d1miha_
    complexed with bef, gol, mn, so4; mutant

Details for d3ffwb_

PDB Entry: 3ffw (more details), 2 Å

PDB Description: crystal structure of chey triple mutant f14q, n59k, e89y complexed with bef3- and mn2+
PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3ffwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ffwb_ c.23.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
adkelkflvvddqstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwkmp
nmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d3ffwb_:

Click to download the PDB-style file with coordinates for d3ffwb_.
(The format of our PDB-style files is described here.)

Timeline for d3ffwb_: