Class a: All alpha proteins [46456] (202 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
Protein Class pi GST [81347] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47619] (36 PDB entries) |
Domain d1eohc1: 1eoh C:77-209 [17576] Other proteins in same PDB: d1eoha2, d1eohb2, d1eohc2, d1eohd2, d1eohe2, d1eohf2, d1eohg2, d1eohh2 |
PDB Entry: 1eoh (more details), 2.5 Å
SCOP Domain Sequences for d1eohc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eohc1 a.45.1.1 (C:77-209) Class pi GST {Human (Homo sapiens)} glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn qggktfivgdqisfaaynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp eyvnlpingngkq
Timeline for d1eohc1: