SCOPe 2.04: Domain d3ffqb_: 3ffq B:

Lineage for d3ffqb_ (3ffq B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187178] (3 PDB entries)

8. Domain d3ffqb_: 3ffq B: [175759]
   automated match to d1q5oa_
   complexed with br

Details for d3ffqb_

PDB Entry: 3ffq, 2.4 Å

PDB Description: HCN2I 443-640 apo-state

PDB Compounds: (B:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d3ffqb_:

Sequence, based on SEQRES records:

>d3ffqb_ b.82.3.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetva

Sequence, based on observed residues (ATOM records):

>d3ffqb_ b.82.3.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmrraf
etva

Timeline for d3ffqb_:

• d3ffqb_ first appeared in SCOPe 2.01
  
• d3ffqb_ appears in SCOPe 2.03
  
• d3ffqb_ appears in SCOPe 2.05
  
• d3ffqb_ appears in the current release, SCOPe 2.08