Lineage for d3ff7a_ (3ff7 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1298299Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1298300Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1298308Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 1298309Species Human (Homo sapiens) [TaxId:9606] [81981] (10 PDB entries)
  8. 1298316Domain d3ff7a_: 3ff7 A: [175740]
    Other proteins in same PDB: d3ff7c_, d3ff7d_
    automated match to d1o6sb_
    complexed with acy

Details for d3ff7a_

PDB Entry: 3ff7 (more details), 1.8 Å

PDB Description: structure of nk cell receptor klrg1 bound to e-cadherin
PDB Compounds: (A:) epithelial cadherin

SCOPe Domain Sequences for d3ff7a_:

Sequence, based on SEQRES records: (download)

>d3ff7a_ b.1.6.1 (A:) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
mdwvippislpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgw
lkvtepldreriatytlfshavssngnavedpmeilitvt

Sequence, based on observed residues (ATOM records): (download)

>d3ff7a_ b.1.6.1 (A:) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
mdwvippislpkgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlkv
tepldreriatytlfshavssngnavedpmeilitvt

SCOPe Domain Coordinates for d3ff7a_:

Click to download the PDB-style file with coordinates for d3ff7a_.
(The format of our PDB-style files is described here.)

Timeline for d3ff7a_: