SCOP 1.67: Domain d1eoha1: 1eoh A:77-209

Lineage for d1eoha1 (1eoh A:77-209)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class pi GST [81347] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (36 PDB entries)

8. Domain d1eoha1: 1eoh A:77-209 [17574]
   Other proteins in same PDB: d1eoha2, d1eohb2, d1eohc2, d1eohd2, d1eohe2, d1eohf2, d1eohg2, d1eohh2

Details for d1eoha1

PDB Entry: 1eoh, 2.5 Å

PDB Description: glutathione transferase p1-1

SCOP Domain Sequences for d1eoha1:

Sequence; same for both SEQRES and ATOM records:

>d1eoha1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfaaynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d1eoha1:

• d1eoha1 first appeared (with stable ids) in SCOP 1.55
  
• d1eoha1 appears in SCOP 1.65
  
• d1eoha1 appears in SCOP 1.69
  
• d1eoha1 appears in the current release, SCOPe 2.08