Lineage for d3fepa_ (3fep A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2804935Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 2804942Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (76 PDB entries)
  8. 2805031Domain d3fepa_: 3fep A: [175735]
    automated match to d1bm5a_
    complexed with lmc, mes; mutant

Details for d3fepa_

PDB Entry: 3fep (more details), 2.6 Å

PDB Description: crystal structure of the r132k:r111l:l121e:r59w-crabpii mutant complexed with a synthetic ligand (merocyanin) at 2.60 angstrom resolution.
PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d3fepa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fepa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvwt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
etmtaddvvctkvyvre

SCOPe Domain Coordinates for d3fepa_:

Click to download the PDB-style file with coordinates for d3fepa_.
(The format of our PDB-style files is described here.)

Timeline for d3fepa_: