Lineage for d3feja_ (3fej A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923666Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 923667Species Human (Homo sapiens) [TaxId:9606] [48525] (59 PDB entries)
    Uniprot P37231 232-505
  8. 923674Domain d3feja_: 3fej A: [175728]
    automated match to d1fm6d_
    complexed with ctm

Details for d3feja_

PDB Entry: 3fej (more details), 2.01 Å

PDB Description: Design and biological evaluation of novel, balanced dual PPARa/g agonists
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3feja_:

Sequence, based on SEQRES records: (download)

>d3feja_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

Sequence, based on observed residues (ATOM records): (download)

>d3feja_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkkevai
rifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgv
lisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpg
llnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkt
etdmslhpllqeiykdly

SCOPe Domain Coordinates for d3feja_:

Click to download the PDB-style file with coordinates for d3feja_.
(The format of our PDB-style files is described here.)

Timeline for d3feja_: